"IL8" Related Products

Expand
Expand

GMP Recombinant Human IL7 protein

Cat.No.: IL8-4323HG
Product Overview: Recombinant Human IL7 was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines.
Description: Interleukin-8 (IL-8) is encoded by the IL8 gene andproduced by macrophages and other cell types such as epithelial cells. It is also synthesized by endothelial cells, which store IL-8 in their storage vesicles. There are many receptors capable to bind IL-8, the most affinity to IL-8 are receptors CXCR1, and CXCR2. As a member of the CXC chemokine family, function of IL-8 is the induction of chemotaxis in its target cells, like neutrophil granulocytes, basophils, and T-cells. IL-8 (72a.a.) has a 5-10-fold higher activity on neutrophil activation, compared to IL-8 (77a.a.). IL-8 is often associated with inflammation and has been cited as a proinflammatory mediator in gingivitis and psoriasis.
Source: E. coli
Species: Human
Form: Lyophilized from a 0.2 µm filtered concentrated solution in PBS, pH 7.4.
Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human CXCR2 transfected mouse BaF3 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10^5 IU/mg.
Molecular Mass: Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids.
AA Sequence: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Endotoxin: Less than 1 EU/µg of rHuIL-8, 72a.a./CXCL8 as determined by LAL method.
Purity: > 97 % by SDS-PAGE and HPLC analyses.
Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw cycles.
Reconstitution: Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name: CXCL8 chemokine (C-X-C motif) ligand 8 [ Homo sapiens ]
Official Symbol: IL8
Synonyms: IL8; NAF; GCP1; LECT; LUCT; NAP1; GCP-1; LYNAP; MDNCF; MONAP; NAP-1; 4q13-q21; interleukin-8; emoctakin; interleukin 8; T-cell chemotactic factor; neutrophil-activating peptide 1; beta-thromboglobulin-like protein; granulocyte chemotactic protein 1; tumor necrosis factor-induced gene 1; alveolar macrophage chemotactic factor I; monocyte-derived neutrophil chemotactic factor; monocyte-derived neutrophil-activating peptide; small inducible cytokine subfamily B, member 8; lymphocyte derived neutrophil activating peptide; lung giant cell carcinoma-derived chemotactic protein; beta endothelial cell-derived neutrophil activating peptide
Gene ID: 3576
mRNA Refseq: NM_000584
Protein Refseq: NP_000575
MIM: 146930
UniProt ID: P10145

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.