Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Toxin > Recombinant H. gigas SNX-482

Recombinant H. gigas SNX-482

   Share
"SNX-482" Related Products.
By Species
By Source
E. coli(1)
Cat.No.:
SNX482-253H
Product Overview:
Recombinant H. gigas SNX-482 was expressed in E. coli.
Description:
SNX-482 is a peptidyl toxin originally isolated from the venom of the spider Hysterocrates gigas. SNX-482 specifically blocks Cav2.3 (a1E, R-type) calcium channels in a voltage dependent manner. SNX-482 also blocks P/Q-type voltage-gated Ca2+ channels and blocks A-type K+ channels (IC50 of <3 nm).
Source:
E. coli
Species:
H. gigas
Molecular Mass:
4495.00
AA Sequence:
GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Purity:
≥98% (HPLC)
Storage:
Store at -20 centigrade
Reconstitution:
Any aqueous buffer. Centrifuge before use (10000 x g for 5 min). After reconstitution, store for 3 months at -20 centigrade or up to four weeks at 2-8 centigrade.
Synonyms:
SNX-482; SNX


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.