"ADAMTS7" Related Products

Expand

Recombinant Human ADAMTS7 protein, GST-tagged

Cat.No.: ADAMTS7-17H
Product Overview: Recombinant Human ADAMTS7(1589 a.a. - 1686 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.52 kDa
Protein length: 1589 a.a. - 1686 a.a.
AA Sequence: VQRRLVKCVNTQTGLPEEDSDQCGHEAWPESSRPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGHQRVARR
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: ADAMTS7 ADAM metallopeptidase with thrombospondin type 1 motif, 7 [ Homo sapiens ]
Official Symbol: ADAMTS7
Synonyms: ADAMTS7; ADAM metallopeptidase with thrombospondin type 1 motif, 7; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7; A disintegrin and metalloproteinase with thrombospondin motifs 7; a disintegrin and metalloprotease with thrombospondin motifs 7 preproprotein; ADAM TS7; COMPase; DKFZp434H204; a disintegrin and metalloprotease with thrombospondin motifs-7 preproprotein; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7; ADAM-TS7; ADAMTS-7; ADAM-TS 7;
Gene ID: 11173
mRNA Refseq: NM_014272
Protein Refseq: NP_055087
MIM: 605009
UniProt ID: Q9UKP4
Chromosome Location: 15pter-qter
Function: metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.