"ANGPTL8" Related Products

Recombinant Human ANGPTL8 protein

Cat.No.: ANGPTL8-190H
Product Overview: Recombinant human Betatrophin cDNA ( 177aa ) was expressed in E. coli.
Source: E. coli
Species: Human
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT.
AA Sequence: MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGAPMGGPEL AQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDI LQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVA QQHRLRQIQERLHTAALPA
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro human Betatrophin signaling pathway regulation study for human pancreatic beta cell differentiation.2. As antigen for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: ANGPTL8 angiopoietin like 8 [ Homo sapiens ]
Official Symbol: ANGPTL8
Synonyms: RIFL; TD26; PRO1185; PVPA599; C19orf80; angiopoietin-like 8; betatrophin variant 1; betatrophin variant 2; hepatocellular carcinoma-associated gene TD26; hepatocellular carcinoma-associated protein TD26; lipasin; refeeding-induced fat and liver protein
Gene ID: 55908
mRNA Refseq: NM_018687
Protein Refseq: NP_061157
MIM: 616223
UniProt ID: Q6UXH0
Chromosome Location: 19p13.2
Function: hormone activity; hormone activity; protein binding

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.