"ANXA2" Related Products

Expand
Expand

Recombinant Human ANXA2 protein

Cat.No.: ANXA2-1846H
Product Overview: Recombinant Human ANXA2(Ser2-Asp339) was expressed in E. coli.
Source: E. coli
Species: Human
Form: Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 150mM NaCl, 1mM EDTA, pH 7.5
Protein length: Ser2-Asp339
AA Sequence: MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSN AQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIE IICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDA RDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLV QCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKG DYQKALLYLCGGDD
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Gene Name: ANXA2 annexin A2 [ Homo sapiens ]
Official Symbol: ANXA2
Synonyms: ANXA2; annexin A2; ANX2, ANX2L4, CAL1H, LPC2D; annexin II; LIP2; annexin-2; protein I; lipocortin II; chromobindin 8; chromobindin-8; calpactin I heavy chain; calpactin-1 heavy chain; calpactin I heavy polypeptide; placental anticoagulant protein IV; P36; ANX2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV;
Gene ID: 302
mRNA Refseq: NM_001002857
Protein Refseq: NP_001002857
MIM: 151740
UniProt ID: P07355
Chromosome Location: 15q22.2
Pathway: Prostaglandin Synthesis and Regulation, organism-specific biosystem;
Function: Rab GTPase binding; calcium ion binding; calcium-dependent phospholipid binding; cytoskeletal protein binding; phosphatidylinositol-4,5-bisphosphate binding; phospholipase inhibitor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.