Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human ATP1A1 protein

Recombinant Human ATP1A1 protein

   Share
"ATP1A1" Related Products.
By Species
By Source
+Expand -Collapse
By Tag
His(5)
MYC/DDK(1)
Cat.No.:
ATP1A1-102H
Product Overview:
Recombinant DNA fragment which encoded for two peptide AG-10 (NRWHSIYITRFG) and AG-32 (TWYKIAFQRNRK) was fully synthesized and fusion to human vitronectin (63-398aa) C-terminal with flexible linker domain (GGGGSGGGGS) for generating VNT-AG10+32 fusion pro
Description:
Human CD49f (Integrin a6) has been demonstrated to be specific membrane protein marker for human hematopoietic stem cell (HSC). Two peptide AG-10 (NRWHSIYITRFG) and AG-32 (TWYKIAFQRNRK), which derived from human laminin-111, has been reported to engage with the α6β1 integrin very specifically. To generate a synthetic matrix protein for coating to maintain HSC culture in vitro, AG-10 and AG-32 peptide was fused to human Vitronectin (VNT) C-terminal as recombinant protein. This recombinant VNT-AG10+32 fusion protein may be served as synthetic matrix protein for interaction with α6β1 integrin positive cells.
Source:
E. coli
Species:
Human
Form:
0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence:
MASMTGGQQMGRGHHHHHHGNLYFQGGEFGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKS KCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTK VNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRT VNRKSTDSPVECMGQEKGEFRE
Purity:
>90% by SDS-PAGE
Applications:
May be used for in vitro integrain alpha 6 receptor mediated cell differentiation, such as HSC or ES cells regulations, study by using VNT-AG10+32 fusion protein as coating matrix in cell culture.
Storage:
Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.