"CDC123" Related Products

Expand
Expand
Expand

Recombinant Human CDC123 protein, T7-tagged

Cat.No.: CDC123-178H
Product Overview: Recombinant human CDC123 (336 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSGRDDPPTHSQPDS DDEAEEIQWSDDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFK SSDFITRDFTQPFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIR RCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSEVDAQEQDSP AFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in eIF2 regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping CDC123-Chf-Gcd11 axis protein–protein interaction.4. May be used as antigen for specific antibody development and potential biomarker development for type 2 diabetes diagnosis.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: CDC123 cell division cycle 123 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol: CDC123
Synonyms: CDC123; cell division cycle 123 homolog (S. cerevisiae); C10orf7, chromosome 10 open reading frame 7; cell division cycle protein 123 homolog; D123; PZ32; HT-1080; C10orf7; FLJ13863;
Gene ID: 8872
mRNA Refseq: NM_006023
Protein Refseq: NP_006014
MIM:
UniProt ID: O75794
Chromosome Location: 10p13

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.