"CLCA1" Related Products

Expand

Recombinant Human CLCA1 protein, His-tagged

Cat.No.: CLCA1-01H
Product Overview: Recombinant Human CLCA1(a.a. 22-695) fused with His tag was expressed in E. coli.
Description: This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine.
Source: E. coli
Species: Human
Tag: His
Form: PBS buffer (pH 7.4).
AA Sequence: NSLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQASLYLFEATGKRFYFKNVAILIPETWKTKADYVRPKL ETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDEYNN DEKFYLSNGRIQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSI VEFCTEQNHNKEAPNKQNQKCNLRSTWEVIRDSEDFKKTTPMTTQPPNPTFSLLQIGQRIVCLVLDKSGSMATGN RLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQNELIQINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVI RKKYPTDGSEIVLLTDGEDNTISGCFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDA FGALSSGNGAVSQRSIQLESKGLTLQNSQWMNGTVIVDSTVGKDTLFLITWTMQPPQILLWDPSGQKQGGFVVDK NTKMAYLQIPGIAKVGTWKYSLQASSQTLTLTVTSRASNATLPPITVTSKTNKDTSKFPSPLVVYANIRQGASPI LRASVTALIESVNGKTVTLELLDNGAGADATKDDGVYSRYFTTYDTNGRYSVKVRALGGVNAARRRVIPQQSG
Purity: > 95% determined by SDS-PAGE.
Storage: For short term, storage it at +4 centigrade, For long term storage, prepare aliquots with 20% glycerol and store at -20 centigrade. Avoid freeze/thaw cycles.
Concentration: 0.31 mg/ml
Gene Name: CLCA1 chloride channel accessory 1 [ Homo sapiens ]
Official Symbol: CLCA1
Synonyms: CLCA1; chloride channel accessory 1; chloride channel regulator 1 , chloride channel, calcium activated, family member 1; calcium-activated chloride channel regulator 1; CaCC; CLCRG1; chloride channel regulator 1; calcium-dependent chloride channel-1; calcium-activated chloride channel protein 1; CLCA family member 1, chloride channel regulator; calcium-activated chloride channel family member 1; chloride channel, calcium activated, family member 1; CACC; GOB5; CACC1; CaCC-1; hCLCA1; hCaCC-1; FLJ95147;
Gene ID: 1179
mRNA Refseq: NM_001285
Protein Refseq: NP_001276
MIM: 603906
UniProt ID: A8K7I4
Chromosome Location: 1p22.3
Pathway: Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Olfactory transduction, organism-specific biosystem; Olfactory transduction, conserved biosystem; Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem;
Function: chloride channel activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.