Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human CNOT8 protein, T7/His-tagged

Recombinant Human CNOT8 protein, T7/His-tagged

   Share
"CNOT8" Related Products.
By Species
+Expand -Collapse
By Source
+Expand -Collapse
By Tag
His(4)
T7/His(1)
Cat.No.:
CNOT8-156H
Product Overview:
Recombinant human POP2 (291aa, derived from BC017366) protein fused with T7-His-TEV cleavage site Tag (29aa)at N-terminal was expressed in E. coli.
Source:
E. coli
Species:
Human
Tag:
T7/His
Form:
1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence:
MASMTGGQQMGRGHHHHHHENLYFQGGEFPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVV VRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQ FQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKY LMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNE DVDSAQEKMSILAIINNMQQ
Purity:
>90% by SDS-PAGE
Applications:
1. May serve as auto-antibodies detection reagent, which will react with sera of some autoimmune-diseases patients.2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for POP2 protein-protein interaction mapping.4. As immunogen for specific antibody production.
Storage:
Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.