"COASY" Related Products

Expand
Expand

Recombinant Human COASY protein, T7-tagged

Cat.No.: COASY-137H
Product Overview: Recombinant human COASY (269aa, Isoform_b) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYERPELP TCLYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGIINRKVLGSRV FGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLVHEVWTAVIPETEAVRRIVERDG LSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPKTHQALD
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: COASY CoA synthase [ Homo sapiens ]
Official Symbol: COASY
Synonyms: COASY; CoA synthase; Coenzyme A synthase; bifunctional coenzyme A synthase; CoASY; DPCK; NBP; PPAT; nucleotide binding protein; phosphopantetheine adenylyltransferase / dephosphocoenzyme A kinase; bifunctional phosphopantetheine adenylyl transferase/dephospho CoA kinase; UKR1; pOV-2; FLJ35179;
Gene ID: 80347
mRNA Refseq: NM_001042529
Protein Refseq: NP_001035994
MIM: 609855
UniProt ID: Q13057
Chromosome Location: 17q12-q21
Pathway: Coenzyme A biosynthesis, organism-specific biosystem; Coenzyme A biosynthesis, pantothenate =>CoA, organism-specific biosystem; Coenzyme A biosynthesis, pantothenate => CoA, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function: ATP binding; dephospho-CoA kinase activity; nucleotide binding; nucleotidyltransferase activity; pantetheine-phosphate adenylyltransferase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.