"CRH" Related Products

Expand
Expand

Recombinant Human CRH protein, T7-tagged

Cat.No.: CRH-217H
Product Overview: Recombinant human CRH fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQENGRGEFLLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPA APLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPI SLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
Purity: >90% by SDS-PAGE.
Applications: 1. Active protein, may be used for in vitro corticotropin regulation study.2. Potential biomarker protein for PPD diagnosis applications.3. As immunogen for specific antibody production.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: CRH corticotropin releasing hormone [ Homo sapiens ]
Official Symbol: CRH
Synonyms: CRH; corticotropin releasing hormone; corticoliberin; corticotropin releasing factor; CRF; corticotropin-releasing factor;
Gene ID: 1392
mRNA Refseq: NM_000756
Protein Refseq: NP_000747
MIM: 122560
UniProt ID: P06850
Chromosome Location: 8q13
Pathway: Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Long-term depression, organism-specific biosystem; Long-term depression, conserved biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem;
Function: corticotropin-releasing hormone activity; corticotropin-releasing hormone receptor 1 binding; corticotropin-releasing hormone receptor 2 binding; hormone activity; neuropeptide hormone activity; protein binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.