"DCTN5" Related Products

Expand
Expand
Expand

Recombinant Human DCTN5 protein, T7-tagged

Cat.No.: DCTN5-140H
Product Overview: Recombinant human DCTN5 (182 aa, Isoform-I) protein fused with 15aa (T7) at N-terminal, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLP PETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro DCTN5 mediated dynein motor regulation study for intracellular cargo transportation by intracellular delivery of this protein with "ProFectin" reagent.2. May be used for mapping DCTN5 protein – protein interaction assay.3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. May be used for specific antibody production.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: DCTN5 dynactin 5 (p25) [ Homo sapiens ]
Official Symbol: DCTN5
Synonyms: DCTN5; dynactin 5 (p25); dynactin subunit 5; MGC3248; p25; dynactin 4; dynactin subunit p25;
Gene ID: 84516
mRNA Refseq: NM_001199011
Protein Refseq: NP_001185940
MIM: 612962
UniProt ID: Q9BTE1
Chromosome Location: 16p12.1
Pathway: Vasopressin-regulated water reabsorption, organism-specific biosystem; Vasopressin-regulated water reabsorption, conserved biosystem;
Function: transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.