"DUSP1" Related Products

Expand

Recombinant Human DUSP1 protein, GST-tagged

Cat.No.: DUSP1-32H
Product Overview: Recombinant Human DUSP1(305 a.a. - 367 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 32.67 kDa
AA Sequence: LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: DUSP1 dual specificity phosphatase 1 [ Homo sapiens ]
Official Symbol: DUSP1
Synonyms: DUSP1; dual specificity phosphatase 1; PTPN10; dual specificity protein phosphatase 1; CL100; HVH1; MKP 1; MAP kinase phosphatase 1; protein-tyrosine phosphatase CL100; dual specificity protein phosphatase hVH1; serine/threonine specific protein phosphatase; mitogen-activated protein kinase phosphatase 1; MKP1; MKP-1;
Gene ID: 1843
mRNA Refseq: NM_004417
Protein Refseq: NP_004408
MIM: 600714
UniProt ID: P28562
Chromosome Location: 5q35.1
Pathway: ATF-2 transcription factor network, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.