"EBF1" Related Products

Expand
Expand

Recombinant Human EBF1 protein, GST-tagged

Cat.No.: EBF1-321H
Product Overview: Recombinant Human EBF1(4-350aa) fused with GST tag at N-terminal was expressed in E. coli.
Description: EBF1 played an important role in many functions.
Source: E. coli
Species: Human
Tag: GST
Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
Molecular Mass: 64 kDa
AA Sequence: IQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQ GQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRV LLTHEIMCSRCCDKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAV SDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSE LITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEP
Storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.Storage of Reconstituted Protein:Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution: Reconsititute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconsitution with 200 μl 50% glycerol solution is recommended for longer term storage.If a different concentration is needed for your purposes please adjust the reconsitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).Note: Centrifuge vial before opening. When reconsituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name: EBF1 early B-cell factor 1 [ Homo sapiens ]
Official Symbol: EBF1
Synonyms: EBF1; early B-cell factor 1; early B cell factor , EBF; transcription factor COE1; OLF1; OE-1; olfactory neuronal transcription factor 1; Collier, Olf and EBF transcription factor 1; EBF; COE1; O/E-1; FLJ39389; FLJ41763;
Gene ID: 1879
mRNA Refseq: NM_024007
Protein Refseq: NP_076870
MIM: 164343
UniProt ID: Q9UH73
Chromosome Location: 5q34
Pathway: Adipogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Transcriptional Regulation of White Adipocyte Differentiation, organism-specific biosystem;
Function: C2H2 zinc finger domain binding; DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.