"EIF3M" Related Products

Expand
Expand

Recombinant Human EIF3M protein, GST-tagged

Cat.No.: EIF3M-394H
Product Overview: Recombinant Human EIF3M(1 a.a. - 374 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 68.9 kDa
Protein length: 1 a.a. - 374 a.a.
AA Sequence: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILE PDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKW ISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLT LKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQE LQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: EIF3M eukaryotic translation initiation factor 3, subunit M [ Homo sapiens ]
Official Symbol: EIF3M
Synonyms: EIF3M; eukaryotic translation initiation factor 3, subunit M; PCI domain containing 1 (herpesvirus entry mediator) , PCID1; eukaryotic translation initiation factor 3 subunit M; eIF3m; FLJ29030; GA17; hfl B5; B5 receptor; fetal lung protein B5; dendritic cell protein; PCI domain-containing protein 1; PCI domain containing 1 (herpesvirus entry mediator); B5; PCID1; hfl-B5;
Gene ID: 10480
mRNA Refseq: NM_006360
Protein Refseq: NP_006351
MIM: 609641
UniProt ID: Q7L2H7
Chromosome Location: 11p13
Function: protein binding; contributes_to translation initiation factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.