"EPCAM" Related Products

Expand
Expand

Recombinant Human EPCAM protein

Cat.No.: EPCAM-77H
Product Overview: Recombinant human EPCAM gene (24-265 aa Fragment) fused with 29aa tag domain (which could be removed using TEV enzyme) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVM KAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWI IIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKD VKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Purity: >90% by SDS-PAGE
Applications: 1. Used as coating matrix protein for Studying ES or iPS cell differentiation in vitro.2. As native antigen for antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: EPCAM epithelial cell adhesion molecule [ Homo sapiens ]
Official Symbol: EPCAM
Synonyms: EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH9
Gene ID: 4072
mRNA Refseq: NM_002354
Protein Refseq: NP_002345
MIM: 185535
UniProt ID: P16422
Chromosome Location: 2p21
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.