"FNDC5" Related Products

Expand

Recombinant Human FNDC5 protein

Cat.No.: FNDC5-125H
Product Overview: Recombinant human FNDC5 cDNA (15 - 127aa) protein was expressed in E. coli.
Source: E. coli
Species: Human
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MDSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHV QAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro human brown fat cell differentiation regulation study.2. May be used for in vitro protein-protein interaction mapping.3. May be used as antigen for specific antibody production.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 15 days.
Gene Name: FNDC5 fibronectin type III domain containing 5 [ Homo sapiens ]
Official Symbol: FNDC5
Synonyms: FNDC5; fibronectin type III domain containing 5; fibronectin type III domain-containing protein 5; FRCP2; fibronectin type III repeat-containing protein 2;
Gene ID: 252995
mRNA Refseq: NM_001171940
Protein Refseq: NP_001165411
MIM: 611906
UniProt ID: Q8NAU1
Chromosome Location: 1p34.3
Function: hormone activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.