"GATA2" Related Products

Expand

Recombinant Human GATA2 protein, Arginine-tagged

Cat.No.: GATA2-136H
Product Overview: Recombinant human GATA2 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: EVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAH ARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGG SGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESG SPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGAT ATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLY YKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGH ILPTPTPIHPSSSLSFGHPHPSSMVTAMGLEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: GATA2 GATA binding protein 2 [ Homo sapiens ]
Official Symbol: GATA2
Synonyms: GATA2; GATA binding protein 2; endothelial transcription factor GATA-2; NFE1B; DCML; MONOMAC; MGC2306; FLJ45948;
Gene ID: 2624
mRNA Refseq: NM_001145661
Protein Refseq: NP_001139133
MIM: 137295
UniProt ID: P23769
Chromosome Location: 3q21
Pathway: Adipogenesis, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; Hemostasis, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; Regulation of Androgen receptor activity, organism-specific biosystem; SIDS Susceptibility Pathways, organism-specific biosystem;
Function: C2H2 zinc finger domain binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; RNA polymerase II distal enhancer sequence-specific DNA binding; chromatin binding; enhancer sequence-specific DNA binding; metal ion binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.