Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human GPR84 protein

Recombinant Human GPR84 protein

   Share
Related Products.
By Species
+Expand -Collapse
By Source
Baculovirus, Sf9 insect cells(1)
Baculovirus(2)
Chinese Hamster Ovarian Cells(1)
Chinese Hamster Ovary Cells (CHO)(1)
E.Coli(3)
Escherichia Coli(52)
HEK293 (Human Embryonic Kidney cell line)(1)
Porcine Pancreas(1)
Saccharomyces cerevisiae(1)
Sf9 insect cells(7)
Submaxillary gland of grown mouse(1)
Yeast(7)
293 cell line (Human embryonic kidney)(1)
Aeromonas Proteolytica(1)
Baculovirus(4)
Baculovirus Sf9 cells(1)
Baculovirus, SF9 insect cells(1)
BTI-Tn-5B1-4 cells(1)
Calf Intestine(1)
Chinese Hamster Ovarian Cells(1)
CHO(2)
CHO (Chinese Hamster Ovarian) cells(1)
CHO Cells(1)
E. coli(100)
E.coli(128)
E.coll(1)
Escherichia coli(87)
HDAC10 was cloned from human lung cDNA and expressed in insect cells using a baculoviral expression system(1)
HDAC11 was cloned from human brain cDNA and expressed in insect cells using a baculoviral expression system(1)
HDAC3 was cloned from human brain cDNA and expressed in insect cells using a baculoviral expression system(1)
HDAC4 was cloned from human brain cDNA and expressed in insect cells using a baculoviral expression system(1)
HDAC5 was cloned from human brain cDNA and expressed in insect cells using a baculoviral expression system(1)
HDAC6 was cloned from human heart cDNA and expressed in insect cells using a baculoviral expression system(1)
HDAC7 was cloned from human heart cDNA and expressed in insect cells using a baculoviral expression system(1)
HDAC8 was cloned from human brain cDNA and expressed in insect cells using a baculoviral expression system(1)
HEK 293(1)
HEK 293 cells(3)
HEK293(4)
HEK-293(1)
Human Cells(32)
Human HEK293 cells(1)
Human Platelets(1)
Insect Cells(9)
Mammalian Cells(2)
Nicotiana benthamiana(5)
Nicotiana Sp.Plant(1)
NS0(1)
Others(1)
Pichia pastoris(4)
Porcine Blood(1)
S.fruigiperda(1)
Saccharomyces cerevisiae(1)
Sf9(1)
Sf9 cells(3)
Sf9 insect cells(3)
Sf9, Insect Cells(1)
Yeast(6)
+Expand -Collapse
By Tag
CaM(1)
Fc(30)
Fc-His(3)
Flag(9)
GST(14)
His(193)
His-GST(1)
MYC/DDK(1)
N/A(241)
None(1)
T7(2)
+Expand -Collapse
Cat.No.:
GPR84-51H
Product Overview:
Recombinant Human GPR84 was expressed in Wheat Germ.
Description:
GPR84 played an important role in many functions.
Source:
Wheat Germ
Species:
Human
Form:
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass:
43.7 kDa
AA Sequence:
MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYCTLLQP FSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVA SFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSN HVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQP IKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTWLNGCINPVLYAAMNR QFRQAYGSILKRGPRSFHRLH
Applications:
Antibody Production Functional; Study Recommended usage: only, not validated yet; Compound Screening: Recommended usage only, not validated yet.
Notes:
Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
Storage:
Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.