"H2AFX" Related Products

Expand
Expand
Expand

Recombinant Human H2AFX protein

Cat.No.: H2AFX-124H
Product Overview: Recombinant human full-length, non-fusion H2AX protein was expressed in E. coli.
Source: E. coli
Species: Human
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK KTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Purity: >90% by SDS-PAGE
Applications: 1. Soluble protein which may be used as substrate for enzymatic assay.2. Active protein, for in vitro histone /DNA reconstitution assay.3. As Immunogen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: H2AFX H2A histone family, member X [ Homo sapiens ]
Official Symbol: H2AFX
Synonyms: H2AFX; H2A histone family, member X; H2AX; histone H2A.x; H2AX histone; H2A.X; H2A/X;
Gene ID: 3014
mRNA Refseq: NM_002105
Protein Refseq: NP_002096
MIM: 601772
UniProt ID: P16104
Chromosome Location: 11q23.3
Pathway: ATM mediated phosphorylation of repair proteins, organism-specific biosystem; ATM mediated response to DNA double-strand break, organism-specific biosystem; Amyloids, organism-specific biosystem; Assembly of the RAD50-MRE11-NBS1 complex at DNA double-strand breaks, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Repair, organism-specific biosystem;
Function: DNA binding; enzyme binding; histone binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.