Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human H3F3A protein, T7/His-tagged

Recombinant Human H3F3A protein, T7/His-tagged

   Share
"H3F3A" Related Products.
By Species
Human(6)
Mouse(2)
Zebrafish(1)
By Source
+Expand -Collapse
By Tag
His(2)
T7/His(1)
Cat.No.:
H3F3A-62H
Product Overview:
Recombinant human Histone 3.3 (H2F3A) cDNA (136aa, which derived from BC066901) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source:
E. coli
Species:
Human
Tag:
T7/His
Form:
0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence:
MASMTGGQQMGRGHHHHHHGNLYFQGGEFARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTV ALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMP KDIQLARRIRGERA
Purity:
>90% by SDS-PAGE
Applications:
1. May be used for in vitro Histone 3.3 mediated HIRA-dependent H3.3 deposition in cell reprogramming regulation study with "ProFectin" based intracellular delivery of this protein.2. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for H3.3 protein-protein interaction mapping.4. May be used as antigen for specific antibody production.
Storage:
Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.