"KIFC1" Related Products

Expand
Expand

Recombinant Human KIFC1 protein, GST-tagged

Cat.No.: KIFC1-43H
Product Overview: Recombinant Human KIFC1(53 a.a. - 152 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: KIFC1 played an important role in many functions.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.41 kDa
AA Sequence: MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTV PQTQGQTTAQKVSKKTGPRCSTAIA
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: KIFC1 kinesin family member C1 [ Homo sapiens ]
Official Symbol: KIFC1
Synonyms: KIFC1; kinesin family member C1; kinesin like 2 , KNSL2; kinesin-like protein KIFC1; HSET; kinesin-like 2; kinesin-like protein 2; kinesin-related protein HSET; KNSL2; MGC1202; MGC149736; MGC149737;
Gene ID: 3833
mRNA Refseq: NM_002263
Protein Refseq: NP_002254
MIM: 603763
UniProt ID: Q9BW19
Chromosome Location: 6p21.32
Pathway: Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Hemostasis, organism-specific biosystem; Kinesins, organism-specific biosystem;
Function: ATP binding; microtubule motor activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.