Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human KLKB1 protein, His-tagged

Recombinant Human KLKB1 protein, His-tagged

   Share
"KLKB1" Related Products.
By Species
Human(7)
Mouse(5)
Pig(1)
Rat(3)
By Tag
His(4)
Cat.No.:
KLKB1-485H
Product Overview:
Recombinant Human KLKB1(Gly20-Ala638) fused with His tag at C-terminal was expressed in HEK293.
Description:
KLKB1 is a 638 amino acids protein that belongs to the peptidase S1 family and plasma kallikrein subfamily. It contains a peptidase S1 domain and four apple domains. The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin. It participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation.Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients.
Source:
HEK293
Species:
Human
Tag :
His
Form:
Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 10% Glycerol, pH8.0
Protein length:
Gly20-Ala638
AA Sequence:
GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVT GTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQF FSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDV DVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGY SLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEK CKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQ VKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQN YKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVN IPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCAR REQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPAVDHHHHHH
Endotoxin:
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity:
Greater than 95% as determined by reducing SDS-PAGE.
Storage:
Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Shipping:
The product is shipped on dry ice/ice packs.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.