"LILRB4" Related Products

Expand
Expand

Recombinant Human LILRB4 protein, GST-tagged

Cat.No.: LILRB4-146H
Product Overview: Recombinant Human LILRB4(1 a.a. - 448 a.a.) fused with GST tag at the N-terminus was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 75.02 kDa
AA Sequence: MIPTFTALLCLGLSLGPRTDMQAGPLPKPTLWAEPGSVISWGNSVTIWCQGTLEAREYRLDKEESPAPWDRQNPL EPKNKARFSIPSMTEDYAGRYRCYYRSPVGWSQPSDPLELVMTGAYSKPTLSALPSPLVTSGKSVTLLCQSRSPM DTFLLIKERAAHPLLHLRSEHGAQQHQAEFPMSPVTSVHGGTYRCFSSHGFSHYLLSHPSDPLELIVSGSLEGPR PSPTRSVSTAAGPEDQPLMPTGSVPHSGLRRHWEVLIGVLVVSILLLSLLLFLLLQHWRQGKHRTLAQRQADFQR PPGAAEPEPKDGGLQRRSSPAADVQGENFCAAVKNTQPEDGVEMDTRQSPHDEDPQAVTYAKVKHSRPRREMASP PSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYARLHSFTLRQKATEPPPSQEGASPAEPSVYATLAIH
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Gene Name: LILRB4 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 4 [ Homo sapiens ]
Official Symbol: LILRB4
Synonyms: HM18; ILT3; LIR5; CD85K; LIR-5; LILRB5
Gene ID: 11006
mRNA Refseq: NM_006847.3
Protein Refseq: NP_006838.3
MIM: 604821
UniProt ID: Q8NHJ6
Chromosome Location: 19q13.4
Pathway: Adaptive Immune System, organism-specific biosystem;Immune System, organism-specific biosystem;Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem;Osteoclast differentiation, organism-specific biosystem;Osteoclast differentiation, conserved biosystem;
Function: antigen binding;protein binding;receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.