"LXN" Related Products

Expand
Expand
Expand

Recombinant Human LXN protein, T7-tagged

Cat.No.: LXN-172H
Product Overview: Recombinant human LXN (222aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEE IIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTL VLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVK HNSRLPKEVQLE
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: LXN latexin [ Homo sapiens ]
Official Symbol: LXN
Synonyms: LXN; latexin; MUM; tissue carboxypeptidase inhibitor; endogenous carboxypeptidase inhibitor; ECI; TCI;
Gene ID: 56925
mRNA Refseq: NM_020169
Protein Refseq: NP_064554
MIM: 609305
UniProt ID: Q9BS40
Chromosome Location: 3q25.32
Function: enzyme inhibitor activity; metalloendopeptidase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.