"MERTK" Related Products

Recombinant Human MERTK protein, His-tagged

Cat.No.: MERTK-149H
Product Overview: Recombinant Human MERTK(Met177-Ala499) fused with His tag at C-terminal was expressed in HEK293.
Source: HEK293
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH8.0.
Protein length: Met177-Ala499
AA Sequence: MKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQ PEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVP GFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVS PWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELL EEVGQNGSRARISVQVHNATCTVRIAAVTKGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNAVD HHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigradefor 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigradefor 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: MERTK c-mer proto-oncogene tyrosine kinase [ Homo sapiens ]
Official Symbol: MERTK
Synonyms: MERTK; c-mer proto-oncogene tyrosine kinase; tyrosine-protein kinase Mer; mer; RP38; STK kinase; proto-oncogene c-Mer; MER receptor tyrosine kinase; receptor tyrosine kinase MerTK; MER; c-mer; MGC133349;
Gene ID: 10461
mRNA Refseq: NM_006343
Protein Refseq: NP_006334
MIM: 604705
UniProt ID: Q12866
Chromosome Location: 2q14.1
Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem;
Function: ATP binding; nucleotide binding; receptor activity; transmembrane receptor protein tyrosine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.