"MKI67" Related Products

Expand

Recombinant Human MKI67 protein, GST-tagged

Cat.No.: MKI67-8543H
Product Overview: Recombinant Human MKI67(3157 a.a. - 3256 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.74 kDa
AA Sequence: RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAE NPKKAEDNVCVKKIRTRSHRDSEDI
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: MKI67 antigen identified by monoclonal antibody Ki-67 [ Homo sapiens ]
Official Symbol: MKI67
Synonyms: MKI67; antigen identified; antigen KI-67; proliferation-related Ki-67 antigen; KIA;
Gene ID: 4288
mRNA Refseq: NM_002417
Protein Refseq: NP_002408
MIM: 176741
UniProt ID: P46013
Chromosome Location: 10q26.2
Function: ATP binding; nucleotide binding; protein C-terminus binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.