"MPO" Related Products

Expand
Expand

Recombinant Human MPO protein, His-tagged

Cat.No.: MPO-493H
Product Overview: Recombinant Human MPO(165-278aa) fused with His tag was expressed in HEK293.
Description: Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of netrophils.
Source: HEK293
Species: Human
Tag: His
Molecular Mass: 17.4kD
Protein length: 165-278aa
AA Sequence: VTCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPT DQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTG
Gene Name: MPO myeloperoxidase [ Homo sapiens ]
Official Symbol: MPO
Synonyms: MPO; myeloperoxidase;
Gene ID: 4353
mRNA Refseq: NM_000250
Protein Refseq: NP_000241
MIM: 606989
UniProt ID: P05164
Chromosome Location: 17q21.3-q23
Pathway: C-MYB transcription factor network, organism-specific biosystem; Folate Metabolism, organism-specific biosystem; IL23-mediated signaling events, organism-specific biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; Selenium Pathway, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem;
Function: chromatin binding; heme binding; heparin binding; metal ion binding; oxidoreductase activity; peroxidase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.