"NANOG" Related Products

Expand
Expand
Expand

Recombinant Human NANOG protein, Arginine-tagged

Cat.No.: NANOG-130H
Product Overview: Recombinant human NANOG protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Bio-activity: DNA binding activity was demonstrated with ELISA using NANOG specific DNA binding oligo.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPH TETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSL QQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWS NQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGE GLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for enhancing PiPS generation efficiency.2. Active protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days
Gene Name: NANOG Nanog homeobox [ Homo sapiens ]
Official Symbol: NANOG
Synonyms: NANOG; Nanog homeobox; homeobox protein NANOG; FLJ12581; FLJ40451; hNanog; homeobox transcription factor Nanog; homeobox transcription factor Nanog-delta 48;
Gene ID: 79923
mRNA Refseq: NM_024865
Protein Refseq: NP_079141
MIM: 607937
UniProt ID: Q9H9S0
Chromosome Location: 12p13.31
Pathway: Wnt Signaling Pathway and Pluripotency, organism-specific biosystem;
Function: DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.