"NRK" Related Products

Recombinant Human NRK protein, GST-tagged

Cat.No.: NRK-15H
Product Overview: Recombinant Human NRK(1483 a.a. - 1582 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: The mouse ortholog of this gene encodes a protein kinase required for JNK activation. The encoded protein may be involved in the induction of actin polymerization in late embryogenesis.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.63 kDa
AA Sequence: VEANEQLFKKILEMWKDIPSSIAFECTQRTTGWGQKAIEVRSLQSRVLESELKRRSIKKLRFLCTRGDKLFFTSTLRNHHSRVYFMTLGKLEELQSNYDV
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: NRK Nik related kinase [ Homo sapiens ]
Official Symbol: NRK
Synonyms: NRK; Nik related kinase; nik-related protein kinase; DKFZp686A17109; NESK; FLJ16788; MGC131849;
Gene ID: 203447
mRNA Refseq: NM_198465
Protein Refseq: NP_940867
MIM: 300791
UniProt ID: Q7Z2Y5
Chromosome Location: Xq22.3
Pathway: TNF receptor signaling pathway, organism-specific biosystem;
Function: ATP binding; nucleotide binding; protein serine/threonine kinase activity; small GTPase regulator activity;
Products Types ◆ Recombinant Protein

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.