"PCDH19" Related Products

Expand

Recombinant Human PCDH19 protein, GST-tagged

Cat.No.: PCDH19-15H
Product Overview: Recombinant Human PCDH19(241 a.a. - 340 a.a.) fused with GST tag at N-terminal was expressed in Wheat germ.
Description: The protein encoded by this gene is a member of the delta-2 protocadherin subclass of the cadherin superfamily. The encoded protein is thought to be a calcium-dependent cell-adhesion protein that is primarily expressed in the brain. Defects in this gene are a cause of epilepsy female-restricted with mental retardation (EFMR). Three transcript variants encoding different isoforms have been found for this gene
Source: Wheat germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.63 kDa
AA Sequence: RLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNTRNTSANHIYHHSFNSQGPQQP DLIINGAPLPETENYSFDSNYVNSR
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: PCDH19 protocadherin 19 [ Homo sapiens ]
Official Symbol: PCDH19
Synonyms: PCDH19; protocadherin 19; EFMR, epilepsy, female restricted, with mental retardation (Juberg Hellman syndrome); protocadherin-19; EIEE9; KIAA1313; EFMR; DKFZp686P1843;
Gene ID: 57526
mRNA Refseq: NM_001105243
Protein Refseq: NP_001098713
MIM: 300460
UniProt ID: Q8TAB3
Chromosome Location: Xq22.1
Function: calcium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.