"PFN2" Related Products

Expand
Expand
Expand

Recombinant Human PFN2 protein, T7-tagged

Cat.No.: PFN2-140H
Product Overview: Recombinant human PFN2 (140 aa, Isoform-1) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYL RDSGF
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro ROCK1 pathway regulation study with intracellular protein delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PFN2 protein-protein interaction.4. As potential diagnostic biomarker for bipolar disorder diseases.5. As antigen for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: PFN2 profilin 2 [ Homo sapiens ]
Official Symbol: PFN2
Synonyms: PFN2; profilin 2; profilin-2; profilin II; PFL; D3S1319E;
Gene ID: 5217
mRNA Refseq: NM_002628
Protein Refseq: NP_002619
MIM: 176590
UniProt ID: P35080
Chromosome Location: 3q25.1
Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, conserved biosystem; Salmonella infection, organism-specific biosystem; Salmonella infection, conserved biosystem; Shigellosis, organism-specific biosystem;
Function: actin binding; phosphatidylinositol-4,5-bisphosphate binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.