"PILRB" Related Products

Recombinant Human PILRB protein, GST-tagged

Cat.No.: PILRB-1722H
Product Overview: Recombinant Human PILRB(1 a.a. - 227 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.74 kDa
Protein length: 81 a.a. - 180 a.a.
AA Sequence: FYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQLQSIKGTKLTITQAVTT TTTWRPSSTTTIAGLRVTESKGHSE
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: PILRB paired immunoglobin-like type 2 receptor beta [ Homo sapiens ]
Official Symbol: PILRB
Synonyms: PILRB; paired immunoglobin-like type 2 receptor beta; paired immunoglobulin-like type 2 receptor beta; FDFACT1; FDFACT2; activating receptor PILRbeta; cell surface receptor FDFACT; activating receptor PILR-beta; cell surface receptor FDFACT1; cell surface receptor FDFACT2; paired immunoglobin-like receptor beta; paired immunoglobulin-like receptor beta;
Gene ID: 29990
mRNA Refseq: NM_178238
Protein Refseq: NP_839956
MIM: 605342
UniProt ID: Q9UKJ0
Chromosome Location: 7q22.1
Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem;
Function: protein binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.