"POU3F2" Related Products

Recombinant Human POU3F2 protein, Arginine-tagged

Cat.No.: POU3F2-132H
Product Overview: Recombinant human POU3F2 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: GEFATAASNHYSLLTSSASIVHAEPPGGMQQGAGGY REAHSLVQGDYGALHSNGHPLSHAHQWITALSHGGGDGSPWSTSPLGQPDIKPSVVVQQGGRG DELHGPGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLP PSMGASNGGLLYSQPSFTVNGMLGAGGQPAGLHHHGLRDAHDEPHHADHHPHPHSHPHQQPPP PPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFS QTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKG ALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSR DTPPHHGVQTPVQLEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for study of Neuronal cell trans-differentiation in vitro.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: POU3F2 POU class 3 homeobox 2 [ Homo sapiens ]
Official Symbol: POU3F2
Synonyms: POU3F2; POU class 3 homeobox 2; BRN2; OCT7; POUF3; brain-2; OTF7; OTF-7; brn-2; oct-7; N-Oct3;
Gene ID: 5454
mRNA Refseq: NM_005604
Protein Refseq: NP_005595
MIM: 600494
UniProt ID: P20265
Chromosome Location: 6q16.2
Pathway: SIDS Susceptibility Pathways, organism-specific biosystem;
Function: RNA polymerase II transcription coactivator activity; identical protein binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.