"PPIF" Related Products

Expand
Expand
Expand

Recombinant Human PPIF protein, T7-tagged

Cat.No.: PPIF-159H
Product Overview: Recombinant human PPIF (207 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFMLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLG RVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHV GPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro mitochondrial mediated cell apoptosis regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PPIF protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: PPIF peptidylprolyl isomerase F [ Homo sapiens ]
Official Symbol: PPIF
Synonyms: PPIF; cyclophilin D; Cyp D; hCyP3; PPIase F; rotamase F; cyclophilin 3; cyclophilin F; CYP3; Cyp-D; FLJ90798; MGC117207;
Gene ID: 10105
mRNA Refseq: NM_005729
Protein Refseq: NP_005720
MIM: 604486
UniProt ID: P30405
Chromosome Location: 10q22-q23
Pathway: Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Parkinsons disease, organism-specific biosystem; Toxoplasmosis, organism-specific biosystem; Toxoplasmosis, conserved biosystem;
Function: cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.