"PVRIG" Related Products

Expand
Expand

Recombinant Human PVRIG protein, GST-tagged

Cat.No.: PVRIG-32H
Product Overview: Recombinant Human PVRIG(38 a.a. - 326 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: PVRIG played an important role in many functions.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 57.53 kDa
AA Sequence: TAGTPEVWVQVRMEATELSSFTIRCGFLGSGSISLVTVSWGGPDGAGGTTLAVLHPERGIRQWAPARQARWETQS SISLILEGSGASSPCANTTFCCKFASFPEGSWEACGSLPPSSDPGLSAPPTPAPILRADLAGILGVSGVLLFGCV YLLHLLRRHKHRPAPRLQPSRTSPQAPRARAWAPSQASQAALHVPYATINTSCRPATLDTAHPHGGPSWWAPLPT HAAHRPQGPAAWASTPIPARGSFVSVENGLYAQAGERPPHTGPGLTLFPDPRGPRAMEGPLGVR
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: PVRIG poliovirus receptor related immunoglobulin domain containing [ Homo sapiens ]
Official Symbol: PVRIG
Synonyms: PVRIG; poliovirus receptor related immunoglobulin domain containing; transmembrane protein PVRIG; C7orf15; MGC2463; poliovirus receptor-related immunoglobulin domain-containing protein; MGC104322; MGC138295; MGC138297;
Gene ID: 79037
mRNA Refseq: NM_024070
Protein Refseq: NP_076975
MIM:
UniProt ID: Q6DKI7
Chromosome Location: 7q22

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.