Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human RAC1 protein, His-tagged

Recombinant Human RAC1 protein, His-tagged

   Share
"RAC1" Related Products.
By Species
Chicken(1)
Human(18)
Mouse(6)
Rat(3)
By Source
+Expand -Collapse
By Tag
GST(4)
His(12)
N/A(1)
Cat.No.:
RAC1-194H
Product Overview:
Recombinant Human RAC1 fused with His tag was expressed in E. coli.
Description:
The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases. Two transcript variants encoding different isoforms have been found for this gene.
Source:
E. coli
Species:
Human
Tag:
His
Form:
20 mM Tris-HCl, 0.15 M NaCl, pH8.0
AA Sequence:
GSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMQAIKCVVVGDGAVGKTCLLISYTTNAFSGEYIPTVFDNYSA NVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTK LDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLL L
Endotoxin:
<1eu/ug as determined by the LAL method
Purity:
~ 90% by SDS-PAGE analysis
Storage:
For long term storage, prepare aliquots and store at -20 centigrade. Avoid freeze/thaw cycles.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.