"RBFOX2" Related Products

Expand
Expand
Expand

Recombinant Human RBFOX2 protein, GST-tagged

Cat.No.: RBFOX2-209H
Product Overview: Recombinant Human RBFOX2(1 a.a. - 450 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 73.6 kDa
AA Sequence: MAEGAQPQQPPQLGPGAAARGMKRESELELPVPGAGGDGADPGLSKRPRTEEAAADGGGGMQNEPLTPGYHGFPA RDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQN GSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFV TFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAAFSFQADVSLG NDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVVYQDG FYGADLYGGYAACRYAQPATATAATAAAAAAAAYGDGYGRVYTADPYHALAPAASYGVGAVASLYRGGYSRFAPY
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: RBFOX2 RNA binding protein, fox-1 homolog (C. elegans) 2 [ Homo sapiens ]
Official Symbol: RBFOX2
Synonyms: RBFOX2; RNA binding protein, fox-1 homolog (C. elegans) 2; RBM9, RNA binding motif protein 9; RNA binding protein fox-1 homolog 2; FOX 2; hexaribonucleotide binding protein 2; HNRBP2; HRNBP2; fox-1 homolog B; fox-1 homologue; RNA-binding motif protein 9; hexaribonucleotide-binding protein 2; repressor of tamoxifen transcriptional activity; RTA; fxh; FOX2; RBM9; Fox-2; dJ106I20.3;
Gene ID: 23543
mRNA Refseq: NM_014309
Protein Refseq: NP_055124
MIM: 612149
UniProt ID: O43251
Chromosome Location: 22q12-q13
Function: RNA binding; nucleotide binding; protein binding; transcription corepressor activity; transcription factor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.