Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human SGK1 protein, His-tagged

Recombinant Human SGK1 protein, His-tagged

   Share
"SGK1" Related Products.
By Species
Chicken(1)
Human(22)
Mouse(18)
Rat(2)
Zebrafish(1)
By Tag
GST(4)
His(5)
T7(1)
Cat.No.:
SGK1-3920H
Product Overview:
Recombinant Human SGK1 fused with His tag at the N-terminus was expressed in Insect cells.
Source:
Insect cells
Species:
Human
Tag:
His
Form:
50 mM Tris/HCl pH7.5, 0.1 mM EGTA, 150 mM NaCl, 0.1% ß­Mercap­toethanol, 270 mM sucrose, 0.03% Brij-35, 1 mM Benzamidine, 0.2 mM PMSF
Bio-activity:
1088 Units/mg (750.8 Units/ml)
Molecular Mass:
~45.5 kDa
AA Sequence:
MSYYHHHHHH DYDIPTT E N LYFQGAMGISQPQEPELMNANPSPPPSPSQQ INLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIM SERNVLLKNVKHPFLVGLHFSFQTADKLYFV LDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIV LTDFGLCKENIEHNSTTSTFCGTPEYLAPE VLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHL LEGLLQKDRTKRLGAKDDFMEIKSHVFFSLIN WDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFL GFDYAPPTDSFL
Purity:
>90% by InstantBlue™ SDS-PAGE
Unit Definition:
1 Unit = 1 nmole of phosphate incorporated into the substrate in 1 minute.
Stability:
12 months at -70 centigrade; aliquot as required.
Storage:
Store at -70 centigrade
Concentration:
0.69 mg/ml


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.