Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-097-1828   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human UCMA protein

Recombinant Human UCMA protein

   Share
"UCMA" Related Products.
By Species
Human(7)
Mouse(16)
Rat(3)
By Tag
GST(1)
His(1)
Cat.No.:
UCMA-22H
Product Overview:
Recombinant Human UCMA(Ser65-Thr138) was expressed in E. coli.
Description:
C10orf49 is a secreted protein which encoded by the UCMA gene. It is a member of the UCMA family. C10orf49 is predominantly expressed in resting chondrocytes. It may be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.
Source:
E. coli
Species:
Human
Form:
Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
AA Sequence:
GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDG LHPSYLYNRHHT
Endotoxin:
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity:
Greater than 95% as determined by reducing SDS-PAGE.
Storage:
Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-097-1828
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.