Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human VTN/TMSB4X protein

Recombinant Human VTN/TMSB4X protein

   Share
"VTN" Related Products.
By Species
Bovine(2)
Chicken(1)
Human(28)
Mouse(10)
Pig(2)
Rabbit(2)
Rat(5)
+Expand -Collapse
By Tag
His(5)
N/A(13)
Cat.No.:
VTN-95H
Product Overview:
Recombinant human vitronectin (62–398aa) domain and full-length human Thymosin-b4 fusion protein cDNA were expressed in E. coli
Source:
E. coli
Species:
Human
Form:
1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Bio-activity:
When coated onto tissue culture plastic, VTB fusion protein promotes one half maximal attachment of human cardiomytes cells in serum-free medium at< 0.1 µg / cm2. Maximum attachment should occur at approximately 0.5 µg / cm2.
AA Sequence:
MTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGID SRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFT RINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQH QPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAP RPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRGGGGSGGGGSNIEFSDKPDMAEIEKFDKSKLKKTETQE KNPLPSKETIEQEKQAGES
Endotoxin:
< 30 EU per 1 µg of the protein by the LAL method
Purity:
>95% by SDS-PAGE
Applications:
1. When coated at 0.5-1 ug/ ml per cm2 and combined with cardiomyocytes culture medium, this recombinant protein can be used as matrix protein for benefiting cardiomyocytes differentiation in vitro.
Storage:
Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.