Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human WNT5A protein, His-tagged

Recombinant Human WNT5A protein, His-tagged

   Share
"WNT5A" Related Products.
By Species
Chicken(1)
Human(13)
Mouse(9)
Rat(3)
Zebrafish(1)
By Tag
GST(2)
His(5)
His/GST(1)
MYC/DDK(1)
N/A(1)
StrepII(1)
+Expand -Collapse
Cat.No.:
WNT5A-1634H
Product Overview:
Recombinant full length human WNT5A protein was expressed in E. coli with C-terminus his tag. This product is for the mature full length protein. The signal peptide and propeptide are not included.
Description:
The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene encodes a member of the WNT family that signals through both the canonical and non-canonical WNT pathways. This protein is a ligand for the seven transmembrane receptor frizzled-5 and the tyrosine kinase orphan receptor 2. This protein plays an essential role in regulating developmental pathways during embryogenesis. This protein may also play a role in oncogenesis. Mutations in this gene are the cause of autosomal dominant Robinow syndrome. Alternate splicing results in multiple transcript variants.
Source:
E. coli
Species:
Human
Tag :
His
Form:
Lyophilized
Molecular Mass:
37 kDa
AA Sequence:
MIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCV RNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH WCCYVKCKKCTEIVDQFVCKLEHHHHH
Purity:
>95% by SDS-PAGE
Storage:
Store at -20 centigrade. Avoid freeze-thaw cycle.
Reconstitution:
Reconstitute in water to a concentration of 0.1 mg/mL. This solution can be diluted in water or other buffer solutions or stored at -20 centigrade.


Online Inquiry    
Fill in the phone number to get a $5 coupon!
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.