Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Mouse Apoe protein, His-tagged

Recombinant Mouse Apoe protein, His-tagged

   Share
"Apoe" Related Products.
By Species
Human(29)
Mouse(6)
Rat(2)
By Source
+Expand -Collapse
By Tag
His(4)
N/A(11)
Trx & His(1)
Cat.No.:
Apoe-25M
Product Overview:
Recombinant Mouse Apoe(Glu19-Gln311) fused with His tag at C-terminal was expressed in HEK293.
Description:
Apolipoprotein E (Apo-E), is a member of the apolipoprotein A1/A4/E family. APOE may function in mediating the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues. APOE is usually secreted in plasma. Phosphorylation sites are present in the extracellular medium.
Source:
HEK293
Species:
Mouse
Tag:
His
Form:
Supplied as a 0.2 μm filtered solution of MOPS, NaCl, CHAPS and TCEP
AA Sequence:
EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKA YKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLS THLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPL RDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPI VEDMHRQWANLMEKIQASVATNPIITPVAQENQVDHHHHHH*
Endotoxin:
Less than 0.1 ng/µg (1 IEU/µg).
Purity:
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage:
Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.