"Eif2ak2" Related Products

Expand
Expand

Recombinant Mouse Eif2ak2 protein, GST-tagged

Cat.No.: EIF2AK2-489M
Product Overview: Recombinant Mouse Eif2ak2 fused with GST tag was expressed in Insect cells.
Description: Eif2ak2 played an important role in many functions.
Source: Insect cells
Species: Mouse
Tag: GST
Molecular Mass: 56.33KD (with GST tag)
AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYI ADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGFGQVFK AKHRIDGKRYAIKRVKYNTEKAEHEVQALAELNHVNIVQYHSCWEGVDYDPEHSMSDTSRYKTRCLFIQMEFCDK GTLEQWMRNRNQSKVDKALILDLYEQIVTGVEYIHSKGLIHRDLKPGNIFLVDERHIKIGDFGLATALENDGKSR TRRTGTLQYMSPEQLFLKHYGKEVDIFALGLILAELLHTCFTESEKIKFFESLRKGDFSNDIFDNKEKSLLKKLL SEKPKDRPETSEILKTLAEWRNISEKKKRNTC
Storage: Short Term Storage at +4 centigrade, Long Term Storage at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles.
Concentration: 0.05 mg/ml
Gene Name: Eif2ak2 eukaryotic translation initiation factor 2-alpha kinase 2 [ Mus musculus ]
Official Symbol: Eif2ak2
Synonyms: EIF2AK2; eukaryotic translation initiation factor 2-alpha kinase 2; interferon-induced, double-stranded RNA-activated protein kinase; p68 kinase; eIF-2 alpha; dsRNA-activated kinase; eIF-2A protein kinase 2; P1/eIF-2A protein kinase; protein kinase RNA-activated; T-cell viral integration site; tyrosine-protein kinase EIF2AK2; serine/threonine-protein kinase TIK; IFN- type I-induced and dsRNA-activated kinase; interferon-inducible RNA-dependent protein kinase; IFN-induced and double-stranded RNA-activated kinase; eukaryotic translation initiation factor 2 alpha kinase 2; protein kinase, interferon inducible double stranded RNA dependent; protein kinase, interferon-inducible double stranded RNA dependent; Pkr; Tik; Prkr; AI467567; AI747578; 2310047A08Rik; 4732414G15Rik;
Gene ID: 19106
mRNA Refseq: NM_011163
Protein Refseq: NP_035293
MIM:
UniProt ID: Q03963
Chromosome Location: 17 49.56 cM; 17 E2
Pathway: Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Measles, organism-specific biosystem;
Function: ATP binding; RNA binding; double-stranded RNA binding; kinase activity; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; protein tyrosine kinase activity; transferase activity; transferase activity, transferring phosphorus-containing groups;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.