Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-097-1828   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Rat IL12 protein, His-tagged

Recombinant Rat IL12 protein, His-tagged

   Share
"IL12" Related Products.
By Species
Human(5)
Mouse(5)
Rat(2)
By Tag
Fc(7)
His(3)
Cat.No.:
IL12-27R
Product Overview:
Recombinant Rat Interleukin-12 is expressed in CHO cells and the target gene encoding Met23-Ser335(p40)&Arg23-Ser215(p35) is expressed with a 6His tag at the C-terminus.
Description:
Interleukin-12 (IL-12), also known as NKSF, TCMF, CLMF and TSF, is a heterodimeric cytokine composed of p35 and p40 subunits. It is produced by monocytes, macrophages, B cells and dendritic cells in response to bacterial lipopolysaccharides and intracellular pathogens. IL-12 signals through the IL-12 receptor complex, which is comprised of IL-12 Rβ1 and IL-12 Rβ2. IL-12 induces the proliferation and activation of hematopoietic stem cells, natural killer cells and T- cells. It is indispensible during the development of Th1 cells, leading to the production of IFN-gamma and IL-2.
Source:
CHO
Species:
Rat
Tag :
His
Form:
Lyophilized after extensive dialysis against PBS.
Bio-activity:
ED50< 0.1ng/ml, measured in a cell proliferation assay using 2D6 cells.
Molecular Mass:
26-28kDa (p35) and 42-45 kDa (p40), observed by reducing SDS-PAGE.
AA Sequence:
p35:RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSSHHHHHH
p40: MWELEKDVYV VEVDWRPDAP GETVTLTCDS PEEDDITWTS DQRRGVIGSG KTLTITVREF LDAGQYTCHR GGETLSHSHL LLHKKENGIW STEILKNFKNKTFLKCEAPN YSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVS WEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS
Endotoxin:
<0.2 EU/μg, determined by LAL method.
Purity:
> 95% as analyzed by SDS-PAGE.
Storage:
Lyophilized recombinant rat Interleukin-12 (IL-12), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rat Interleukin-12 (IL-12), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Reconstitution:
Reconstituted in ddH2O or PBS at 100 μg/ml.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-097-1828
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.