Synthesized Human B-type Natriuretic Peptide

• Cat.No.: NPPB-1857H
• Product Overview: B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. The molecular formula is:C143H244N50O42S4.

Specification

• Description: Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder. The protein was lyophilized without additives.
• AA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
• Purity: Greater than 95.0% as determined by RP-HPLC.
• Storage: Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution B-type Natriuretic Peptide should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
• Reconstitution: It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Gene Information

• Gene Name: NPPB natriuretic peptide B [ Homo sapiens ]
• Official Symbol: NPPB
• Synonyms: NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP
• Gene ID: 4879
• mRNA Refseq: NM_002521
• Protein Refseq: NP_002512
• MIM: 600295
• UniProt ID: P16860
• Chromosome Location: 1p36.2
• Pathway: MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem
• Function: diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding