Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-097-1828   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Mouse Fibroblast Growth Factor 7

Recombinant Mouse Fibroblast Growth Factor 7

   Share
"Fgf7" Related Products.
Cat. No.:
Fgf7-649M
Product Overview:
Recombinant Mouse Fibroblast Growth Factor-7 is a single, non-glycosylated polypeptide chain containing 164 amino acids.
Description:
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis.
Source:
E. coli
Molecular Mass:
18.9 kDa
Formulation:
Lyophilized from a 0.2µm filtered solution in 20 mM PBS, pH 8.0 + 1M NaCl.
Purity:
>96% as determined by SDS­PAGE and HPLC analyses.
Endotoxin Level:
<0.1 ng/µg of protein
Biological Activity:
The biological activity was determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing KGF receptors yielding an ED50 < 10 ng/ml.
Amino Acid Sequence:
MCNDMSPEQT ATSVNCSSPE RHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFK ELILENHYNT YASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLP MAIT
Reconstitution:
Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1 to 1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at -20 °C to -80 °C. Further dilutions should be made in appropriate buffered solutions.
Storage:
Store at -20 °C, preferably desiccated. Upon reconstitution, the preparation is stable for up to 1 week at 2-4 °C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -80 °C. Avoid repeated freeze/thaw cycles.
OfficialSymbol:
Fgf7


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-097-1828
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.