Recombinant Mouse Adiponectin, C1Q And Collagen Domain Containing
Cat.No. : | Adipoq-5373M |
Product Overview : | Recombinant MouseAdipoq (aa 111-247) is the globular domain of Mouse Adipoq, containing 138amino acid residues from aa 111-247. |
- Specification
- Gene Information
- Related Products
Cat. No. : | Adipoq-5373M |
Description : | Thereare four distinct regions of Adipoq. The first is ashort signal sequence that targets the hormone for secretion outside thecell; next is a short region that varies between species; the third is a65-amino acid region with similarity to collagenous proteins; the last is aglobular domain. Overall this gene shows similarity to the complement 1Qfactors. However, when the 3-dimensional structure of the globular region wasdetermined, a striking similarity to TNFα was observed, despite unrelatedprotein sequences. |
Source : | E. coli |
Species : | Mouse |
Form : | Liquid in 20 mMTris-HCl, pH 7.5 + 50 mM NaCl + 5 mM DTT + 10% glycerol. |
Purity : | > 95.0% asdetermined by RP-HPLC and SDS-PAGE analyses. |
Endotoxin Level : | < 0.1 ng/μg ofAdipoQ. |
Amino Acid Sequence : | MAYMYRSAFSVGLETRVTVP NVPIRFTKIF YNQQNHYDGS TGKFYCNIPG LYYFSYHITVYMKDVKVSLFKKDKAVLFTY DQYQEKNVDQ ASGSVLLHLE VGDQVWLQVYGDGDHNGLYADNVNDSTFTG FLLYHDTN |
Molecular Weight : | 16 kDa |
Concentration : | 1 mg/ml |
Storage : | Store at -20°C to-80°C. Avoidrepeated freeze-thaw cycles. |
OfficialSymbol : | Adipoq |
Gene Name : | Adipoq adiponectin, C1Q andcollagen domain containing [ Mus musculus ] |
Synonyms : | Adipoq; adiponectin,C1Q and collagen domain containing; APN; Acdc; apM1; 30kDa; GBP28; adipo;Acrp30; adiponectin; OTTMUSP00000050447; adipocyte-specific protein AdipoQ;adipocyte complement related protein; 30 kDa adipocyte complement-relatedprotein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q andcollagen domain containing; adipocyte, C1q and collagen domain-containingprotein |
Gene ID : | 11450 |
mRNA Refseq : | NM_009605 |
Protein Refseq : | NP_033735 |
Chromosome Location : | 16 B3-B4;16 16.0 cM |
Pathway : | Adipocytokinesignaling pathway; Adipogenesis; Leptin and adiponectin; PPAR signalingpathway; Type II diabetes mellitus |
Function : | eukaryotic cellsurface binding; hormone activity; protein binding; protein homodimerizationactivity; receptor binding; sialic acid binding |
Products Types
◆ Recombinant Protein | ||
Adipoq-033M | Active Recombinant Mouse Adipoq Protein, His-tagged | +Inquiry |
ADIPOQ-1362M | Recombinant Mouse ADIPOQ Protein, His-tagged | +Inquiry |
ADIPOQ-03H | Recombinant Human ADIPOQ Protein | +Inquiry |
Adipoq-17M | Active Recombinant Mouse Adipoq Protein | +Inquiry |
Adipoq-032M | Recombinant Mouse Adipoq Protein, His-tagged | +Inquiry |
◆ Native Protein | ||
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
◆ Lysates | ||
ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (12)
Ask a questionThere is limited research on the use of ADIPOQ proteins in cancer treatment. However, some studies have suggested that ADIPOQ proteins may have a protective effect against certain types of cancers, including breast, colon, and prostate cancer.
Various conditions and diseases can affect ADIPOQ protein levels, including type 2 diabetes, obesity, metabolic syndrome, polycystic ovary syndrome, and certain cancers.
Yes, ADIPOQ levels can be modulated through lifestyle changes. Regular exercise and weight loss can increase ADIPOQ levels in the blood, while a diet high in saturated fats and sugar can decrease ADIPOQ levels.
Yes, ADIPOQ proteins have been shown to have a protective effect on cardiovascular health. High levels of ADIPOQ proteins are associated with lower risk of cardiovascular disease, while low levels of ADIPOQ proteins are associated with increased risk.
Lifestyle changes such as diet and exercise can significantly affect ADIPOQ protein levels. Eating a healthy diet and maintaining a healthy weight can increase circulating levels of ADIPOQ proteins, while sedentary lifestyle and obesity can decrease ADIPOQ protein levels.
Low levels of ADIPOQ proteins in the circulation have been associated with obesity and an increased risk of metabolic disorders such as insulin resistance and type 2 diabetes. High levels of ADIPOQ proteins, on the other hand, have been associated with better insulin sensitivity and a lower risk of metabolic disorders.
Some medications, such as thiazolidinediones (TZDs), commonly used to treat type 2 diabetes, can increase ADIPOQ levels and improve insulin sensitivity. However, other medications, such as glucocorticoids, used to treat inflammatory conditions, can reduce ADIPOQ levels and worsen insulin resistance.
ADIPOQ protein levels can be measured in the circulation using a blood test or through adipose tissue biopsies. The blood test is a more commonly used diagnostic tool to evaluate ADIPOQ protein levels due to its non-invasive nature.
Yes, measuring circulating levels of ADIPOQ proteins can be used as a biomarker for metabolic disorders such as insulin resistance and type 2 diabetes. Low levels of ADIPOQ proteins are associated with an increased risk of these disorders.
Currently, there are no medications that target ADIPOQ proteins directly. However, drugs that improve insulin sensitivity and metabolic function, such as thiazolidinediones (TZDs) and metformin, have been shown to increase circulating levels of ADIPOQ proteins.
As research continues to explore the role of ADIPOQ proteins in various physiological processes, they may have potential future applications for the prevention and treatment of metabolic disorders, cardiovascular disease, infertility, and certain types of cancer. Additionally, ADIPOQ proteins may serve as a biomarker for disease and treatment response.
Customer Reviews (5)
Write a reviewthe quality of the ADIPOQ protein used in experiments is of utmost importance and can significantly impact the accuracy and reliability of the results obtained.
The packaging and shipping of the protein were both efficient and effective, ensuring that the product arrived in good condition and ready to use.
The protein's stability and shelf-life have exceeded my expectations, allowing me to use it for multiple experiments without worrying about degradation or loss of potency.
In this regard, using a protein of very high quality that meets your experimental needs is essential.
It will ensure that your results are both valid and reproducible, providing you with valuable insights into the expression and function of ADIPOQ.
Ask a Question for All Adipoq Products
Required fields are marked with *
My Review for All Adipoq Products
Required fields are marked with *
Inquiry Basket