Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-097-1828   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human Bone Morphogenetic Protein 4

Recombinant Human Bone Morphogenetic Protein 4

   Share
"Bmp4" Related Products.
By Species
Chicken(2)
Human(26)
Mouse(10)
Pig(2)
Rabbit(2)
Rat(6)
Zebrafish(2)
+Expand -Collapse
By Source
+Expand -Collapse
By Tag
Fc(2)
GST(1)
His(13)
His & GST(1)
His & T7(1)
His/S(3)
His-MBP(1)
Met(1)
N/A(5)
+Expand -Collapse
Cat. No.:
BMP4-22H
Product Overview:
Recombinanthuman BMP4 produced in E. coli was a fully active homodimeric proteinconsisting of two 106 amino acid subunits which correspond to amino acids303-408 of the full length BMP-4 precursor.
Description:
Bone morphogenetic proteins (BMPs) constitute asubfamily within the TGF-β superfamily of structurally relatedsignaling proteins. Members of this superfamily are widely distributedthroughout the body and are involved in diverse physiological processesduring both pre- and postnatal life. Like BMP-7, BMP-4 is involved in the developmentand maintenance of bone and cartilage. Reduced expression of BMP-4 isassociated with a number of bone diseases, including the heritable disorderFibrodysplasia Ossificans Progressiva.
Source:
E. coli
Purity:
Greater than 98% bySDS-PAGE gel and HPLC analyses.
Biological Activity:
Determinedby its ability to induce alkaline phosphatase production by ATDC-5 cells. Theexpected ED50 for this effect is 5-10 ng/ml.
AA Sequence:
KKNKNCRRHS LYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Cross Reactivity:
Mouse
OfficialSymbol:
Bmp4


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-097-1828
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.