Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Antibody > Polyclonal Antibody > Rabbit Anti-PLGRKT Polyclonal Antibody

Rabbit Anti-PLGRKT Polyclonal Antibody

   Share
"PLGRKT" Related Products.
By Species
By Source
By Tag
His(3)
N/A(1)
Cat.No.:
DPAB8782
Product Overview:
Rabbit Anti-PLGRKT Polyclonal Antibody
Target:
PLGRKT
Immunogen:
Recombinant protein corresponding to amino acids of human C9orf46.
Host:
Rabbit
Isotype:
IgG
Source:
Rabbit
species:
Human
Purification:
Antigen affinity purification
Conjugation:
N/A
Applications:
WB,IHC-P
Sequence similarities:
KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK
Usage recommendation:
Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.
Storage:
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Size:
100 uL


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.