"PLGRKT" Related Products

Expand

Rabbit Anti-PLGRKT Polyclonal Antibody

Cat.No.: DPAB8782
Product Overview: Rabbit Anti-PLGRKT Polyclonal Antibody
Target: PLGRKT
Immunogen: Recombinant protein corresponding to amino acids of human C9orf46.
Host: Rabbit
Isotype: IgG
Source: Rabbit
species: Human
Purification: Antigen affinity purification
Conjugation: N/A
Applications: WB,IHC-P
Sequence similarities: KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK
Usage recommendation: Immunohistochemistry (1:200-1:500)Western Blot (1:250-1:500)The optimal working dilution should be determined by the end user.
Storage: Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Size: 100 uL
Gene Name: PLGRKT plasminogen receptor,C-terminal lysine transmembrane protein [ Homo sapiens ]
Official Symbol: PLGRKT
Synonyms: AD025;MDS030;C9orf46;PLG-RKT;Plg-R(KT)
Gene ID: 55848
mRNA Refseq: NM_018465.3
Protein Refseq: NP_060935.2
UniProt ID: Q9HBL7
Chromosome Location: 9p24.1

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.